Lineage for d5cbee_ (5cbe E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2929386Family d.9.1.0: automated matches [191483] (1 protein)
    not a true family
  6. 2929387Protein automated matches [190775] (3 species)
    not a true protein
  7. 2929388Species Human (Homo sapiens) [TaxId:9606] [188003] (12 PDB entries)
  8. 2929417Domain d5cbee_: 5cbe E: [278844]
    Other proteins in same PDB: d5cbea_, d5cbeb_, d5cbec_, d5cbed_
    automated match to d1ikma_
    complexed with edo

Details for d5cbee_

PDB Entry: 5cbe (more details), 2.4 Å

PDB Description: e10 in complex with cxcl13
PDB Compounds: (E:) C-X-C motif chemokine 13

SCOPe Domain Sequences for d5cbee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cbee_ d.9.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yytslrcrcvqessvfiprrfidriqilprgngcprkeiivwkknksivcvdpqaewiqr
mmev

SCOPe Domain Coordinates for d5cbee_:

Click to download the PDB-style file with coordinates for d5cbee_.
(The format of our PDB-style files is described here.)

Timeline for d5cbee_: