Lineage for d5ca1d1 (5ca1 D:1-243)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843633Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843634Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1843635Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1843745Protein automated matches [226837] (6 species)
    not a true protein
  7. 1843811Species Gallus gallus [TaxId:9031] [278810] (1 PDB entry)
  8. 1843813Domain d5ca1d1: 5ca1 D:1-243 [278838]
    Other proteins in same PDB: d5ca1a2, d5ca1b2, d5ca1c2, d5ca1d2, d5ca1e_
    automated match to d4drxb1
    complexed with acp, ca, gdp, gol, gtp, mes, mg, nzo

Details for d5ca1d1

PDB Entry: 5ca1 (more details), 2.4 Å

PDB Description: crystal structure of t2r-ttl-nocodazole complex
PDB Compounds: (D:) Tubulin beta-2 chain

SCOPe Domain Sequences for d5ca1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ca1d1 c.32.1.1 (D:1-243) automated matches {Gallus gallus [TaxId: 9031]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5ca1d1:

Click to download the PDB-style file with coordinates for d5ca1d1.
(The format of our PDB-style files is described here.)

Timeline for d5ca1d1: