SCOPe 2.08: Domain d5ca1c2: 5ca1 C:246-440

Lineage for d5ca1c2 (5ca1 C:246-440)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Sus barbatus [TaxId:41807] [278826] (7 PDB entries)

8. Domain d5ca1c2: 5ca1 C:246-440 [278837]
   Other proteins in same PDB: d5ca1a1, d5ca1b1, d5ca1c1, d5ca1d1, d5ca1e_, d5ca1f1, d5ca1f2, d5ca1f3
   automated match to d4i50a2
   complexed with acp, ca, gdp, gol, gtp, mes, mg, nzo

Details for d5ca1c2

PDB Entry: 5ca1, 2.4 Å

PDB Description: crystal structure of t2r-ttl-nocodazole complex

PDB Compounds: (C:) Tubulin alpha

SCOPe Domain Sequences for d5ca1c2:

Sequence; same for both SEQRES and ATOM records:

>d5ca1c2 d.79.2.1 (C:246-440) automated matches {Sus barbatus [TaxId: 41807]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d5ca1c2:

• d5ca1c2 first appeared in SCOPe 2.05
  
• d5ca1c2 appears in SCOPe 2.07