SCOPe 2.05: Domain d5c8yc1: 5c8y C:1-245

Lineage for d5c8yc1 (5c8y C:1-245)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (6 species)
   not a true protein

7. Species Sus barbatus [TaxId:41807] [278811] (3 PDB entries)

8. Domain d5c8yc1: 5c8y C:1-245 [278830]
   Other proteins in same PDB: d5c8ya2, d5c8yb2, d5c8yc2, d5c8yd2, d5c8ye_
   automated match to d4ihja1
   complexed with acp, ca, gdp, gtp, mes, mg, pn6

Details for d5c8yc1

PDB Entry: 5c8y, 2.59 Å

PDB Description: crystal structure of t2r-ttl-plinabulin complex

PDB Compounds: (C:) Tubulin alpha

SCOPe Domain Sequences for d5c8yc1:

Sequence; same for both SEQRES and ATOM records:

>d5c8yc1 c.32.1.1 (C:1-245) automated matches {Sus barbatus [TaxId: 41807]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d5c8yc1:

• d5c8yc1 is new in SCOPe 2.05-stable
  
• d5c8yc1 appears in SCOPe 2.06
  
• d5c8yc1 appears in the current release, SCOPe 2.08