SCOPe 2.08: Domain d5ca1b1: 5ca1 B:2-243

Lineage for d5ca1b1 (5ca1 B:2-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [278810] (2 PDB entries)

8. Domain d5ca1b1: 5ca1 B:2-243 [278822]
   Other proteins in same PDB: d5ca1a2, d5ca1b2, d5ca1c2, d5ca1d2, d5ca1e_, d5ca1f1, d5ca1f2, d5ca1f3
   automated match to d4drxb1
   complexed with acp, ca, gdp, gol, gtp, mes, mg, nzo

Details for d5ca1b1

PDB Entry: 5ca1, 2.4 Å

PDB Description: crystal structure of t2r-ttl-nocodazole complex

PDB Compounds: (B:) Tubulin beta-2 chain

SCOPe Domain Sequences for d5ca1b1:

Sequence; same for both SEQRES and ATOM records:

>d5ca1b1 c.32.1.1 (B:2-243) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

Timeline for d5ca1b1:

• d5ca1b1 first appeared in SCOPe 2.05
  
• d5ca1b1 appears in SCOPe 2.07