SCOPe 2.05: Domain d5ca0b1: 5ca0 B:3-243

Lineage for d5ca0b1 (5ca0 B:3-243)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (6 species)
   not a true protein

7. Species Sus scrofa [TaxId:9823] [278808] (1 PDB entry)

8. Domain d5ca0b1: 5ca0 B:3-243 [278814]
   Other proteins in same PDB: d5ca0a2, d5ca0b2, d5ca0c2, d5ca0d2, d5ca0e_
   automated match to d4drxb1
   complexed with acp, ca, gdp, gol, gtp, lxl, mes, mg

Details for d5ca0b1

PDB Entry: 5ca0, 2.5 Å

PDB Description: crystal structure of t2r-ttl-lexibulin complex

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d5ca0b1:

Sequence; same for both SEQRES and ATOM records:

>d5ca0b1 c.32.1.1 (B:3-243) automated matches {Sus scrofa [TaxId: 9823]}
eivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvpr
ailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvrk
esescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvvep
ynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclrf
p

Timeline for d5ca0b1:

• d5ca0b1 is new in SCOPe 2.05-stable
  
• d5ca0b1 appears in SCOPe 2.06
  
• d5ca0b1 appears in the current release, SCOPe 2.08