SCOPe 2.06: Domain d5ah0b1: 5ah0 B:17-402

Lineage for d5ah0b1 (5ah0 B:17-402)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Pelosinus fermentans [TaxId:1122947] [278791] (1 PDB entry)

8. Domain d5ah0b1: 5ah0 B:17-402 [278801]
   Other proteins in same PDB: d5ah0a2, d5ah0b2
   automated match to d1ku0b_
   complexed with k, peg, zn

Details for d5ah0b1

PDB Entry: 5ah0, 2.5 Å

PDB Description: structure of lipase 1 from pelosinus fermentans

PDB Compounds: (B:) Lipase

SCOPe Domain Sequences for d5ah0b1:

Sequence; same for both SEQRES and ATOM records:

>d5ah0b1 c.69.1.0 (B:17-402) automated matches {Pelosinus fermentans [TaxId: 1122947]}
nsypivlvhgfmgwgrnevlglkywggitdyeqelssygytaytatvgpvssnwdracel
yayikggtvdyghahstqkghsrygrtypglypewgnlttegkvnkihlvahsmggqtvr
tlvqllkegseeernttpsqlsslfaggkswvhsittiasphdgttladginifgdfakn
lvaslasftgagekliydfkldqwglnrksgesltdytnrvfnsaiwnstndlanwdlst
dgarvlnqwvkaqsdiyyfsystcatvpsiltsnelphviymtpllypfgrfigsytrne
qgrviidnswkpndgvvntisqngpkiwssdkivnyngvpqigkwnsmplldtidhmdac
gigtnaltlswykglaeklsqltisn

Timeline for d5ah0b1:

• d5ah0b1 first appeared in SCOPe 2.05, called d5ah0b_
  
• d5ah0b1 appears in SCOPe 2.07
  
• d5ah0b1 appears in the current release, SCOPe 2.08