Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (26 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [278787] (1 PDB entry) |
Domain d5ab8a_: 5ab8 A: [278800] automated match to d1dlwa_ complexed with act, fmt, gol, hem |
PDB Entry: 5ab8 (more details), 1.53 Å
SCOPe Domain Sequences for d5ab8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ab8a_ a.1.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} pisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqveffaaalggpep ytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviaplavdvts
Timeline for d5ab8a_: