Lineage for d5ab8a_ (5ab8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689497Species Mycobacterium tuberculosis [TaxId:1773] [278787] (1 PDB entry)
  8. 2689498Domain d5ab8a_: 5ab8 A: [278800]
    automated match to d1dlwa_
    complexed with act, fmt, gol, hem

Details for d5ab8a_

PDB Entry: 5ab8 (more details), 1.53 Å

PDB Description: high resolution x-ray structure of the n-terminal truncated form (residues 1-11) of mycobacterium tuberculosis hbn
PDB Compounds: (A:) group 1 truncated hemoglobin glbn

SCOPe Domain Sequences for d5ab8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ab8a_ a.1.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkqveffaaalggpep
ytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviaplavdvts

SCOPe Domain Coordinates for d5ab8a_:

Click to download the PDB-style file with coordinates for d5ab8a_.
(The format of our PDB-style files is described here.)

Timeline for d5ab8a_: