Lineage for d5abna_ (5abn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005953Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2005954Protein automated matches [191104] (11 species)
    not a true protein
  7. 2006037Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)
  8. 2006057Domain d5abna_: 5abn A: [278788]
    automated match to d2boqa_
    complexed with ca, hem, mg; mutant

Details for d5abna_

PDB Entry: 5abn (more details), 2.19 Å

PDB Description: crystal structure analysis of fungal versatile peroxidase from pleurotus eryngii. mutant vpi. mutated residues d69s, t70d, s86e, d146t, q202l, h232e, q239r and s301k.
PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d5abna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5abna_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
tcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggga
dgsiiafsdietnfpanagideiveaqkpfvakhnisagdfiqfagavgvsncpggvrip
fflgrpdavaaspdhlvpepfdsvtsilarmgdagfspvevvwllashsiaaadkvdpsi
pgtpfdstpgvfdsqffietllkgrlfpgtadnkgeaqsplqgeirlqsdellardprta
cewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfslk
dveqacaatpfpaltadpgpvtsvpp

SCOPe Domain Coordinates for d5abna_:

Click to download the PDB-style file with coordinates for d5abna_.
(The format of our PDB-style files is described here.)

Timeline for d5abna_: