SCOPe 2.07: Domain d4whua1: 4whu A:1080-1197

Lineage for d4whua1 (4whu A:1080-1197)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein CREB-binding protein, CBP [74712] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74713] (37 PDB entries)

8. Domain d4whua1: 4whu A:1080-1197 [278762]
   Other proteins in same PDB: d4whua2
   automated match to d3p1fa_
   complexed with 3ot

Details for d4whua1

PDB Entry: 4whu, 2.11 Å

PDB Description: bromo domain of creb binding protein

PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d4whua1:

Sequence; same for both SEQRES and ATOM records:

>d4whua1 a.29.2.1 (A:1080-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
mrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstik
rkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

Timeline for d4whua1:

• d4whua1 first appeared in SCOPe 2.05, called d4whua_
  
• d4whua1 appears in SCOPe 2.06
  
• d4whua1 appears in the current release, SCOPe 2.08