SCOPe 2.05: Domain d4ro0d2: 4ro0 D:245-336

Lineage for d4ro0d2 (4ro0 D:245-336)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
   beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold

4. Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families)

5. Family d.286.1.0: automated matches [228502] (1 protein)
   not a true family

6. Protein automated matches [228504] (1 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [228505] (8 PDB entries)

8. Domain d4ro0d2: 4ro0 D:245-336 [278725]
   Other proteins in same PDB: d4ro0a1, d4ro0b1, d4ro0c1, d4ro0d1, d4ro0e1, d4ro0f1, d4ro0g1, d4ro0h1, d4ro0i1, d4ro0j1, d4ro0k1, d4ro0l1, d4ro0m1, d4ro0n1, d4ro0o1, d4ro0p1, d4ro0q1, d4ro0r1, d4ro0s1, d4ro0t1
   automated match to d2aema2

Details for d4ro0d2

PDB Entry: 4ro0, 3.18 Å

PDB Description: crystal structure of mthk gating ring in a ligand-free form

PDB Compounds: (D:) Calcium-gated potassium channel mthK

SCOPe Domain Sequences for d4ro0d2:

Sequence; same for both SEQRES and ATOM records:

>d4ro0d2 d.286.1.0 (D:245-336) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

Timeline for d4ro0d2:

• d4ro0d2 is new in SCOPe 2.05-stable
  
• d4ro0d2 appears in SCOPe 2.06
  
• d4ro0d2 appears in the current release, SCOPe 2.08