Lineage for d4rncb_ (4rnc B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510380Species Rhodococcus sp. [TaxId:1831] [278711] (1 PDB entry)
  8. 2510382Domain d4rncb_: 4rnc B: [278716]
    Other proteins in same PDB: d4rnca2
    automated match to d4pw0a_
    complexed with po4

Details for d4rncb_

PDB Entry: 4rnc (more details), 1.95 Å

PDB Description: crystal structure of an esterase rhest1 from rhodococcus sp. ecu1013
PDB Compounds: (B:) esterase

SCOPe Domain Sequences for d4rncb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rncb_ c.69.1.0 (B:) automated matches {Rhodococcus sp. [TaxId: 1831]}
msireavsvdgtsivyrvtgnsagtplvllhgwaqssqcwgeqvladlaadyrliavdlr
ghgysdapesgyddsanwagdvaavlaaegvtenaillgwsygglvicdylaahgtgava
gavlvgaitsigrgekggkvgsamrsavpgamsedpreairalgafgnaltgppegkgaa
sqalfgyslstrprvraalfnravghdellrnldipvlvlhgtddsvvdvsagkhaeeli
pksqasywvgcnhgpfvedptrfvsevrtfisslg

SCOPe Domain Coordinates for d4rncb_:

Click to download the PDB-style file with coordinates for d4rncb_.
(The format of our PDB-style files is described here.)

Timeline for d4rncb_: