SCOPe 2.06: Domain d2n8ga1: 2n8g A:2-71

Lineage for d2n8ga1 (2n8g A:2-71)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189258] (25 PDB entries)

8. Domain d2n8ga1: 2n8g A:2-71 [278708]
   Other proteins in same PDB: d2n8ga2
   automated match to d2m34a_

Details for d2n8ga1

PDB Entry: 2n8g

PDB Description: nmr structure of the homeodomain transcription factor gbx1[e23r,r58e] from homo sapiens

PDB Compounds: (A:) Homeobox protein GBX-1

SCOPe Domain Sequences for d2n8ga1:

Sequence; same for both SEQRES and ATOM records:

>d2n8ga1 a.4.1.0 (A:2-71) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apggksrrrrtaftseqllelrkefhckkylsltersqiahalklsevqvkiwfqnerak
wkrikagnvs

Timeline for d2n8ga1:

• d2n8ga1 first appeared in SCOPe 2.05, called d2n8ga_
  
• d2n8ga1 appears in SCOPe 2.07
  
• d2n8ga1 appears in the current release, SCOPe 2.08