SCOPe 2.05: Domain d5e6eb_: 5e6e B:

Lineage for d5e6eb_ (5e6e B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (225 PDB entries)
   Uniprot P68871

8. Domain d5e6eb_: 5e6e B: [278702]
   Other proteins in same PDB: d5e6ea_
   automated match to d2hbsb_
   complexed with cmo, hem, mbn, po4

Details for d5e6eb_

PDB Entry: 5e6e, 1.76 Å

PDB Description: crystal structure of carbonmonoxy sickle hemoglobin in r-state conformation

PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d5e6eb_:

Sequence; same for both SEQRES and ATOM records:

>d5e6eb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpveksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d5e6eb_:

• d5e6eb_ appears in SCOPe 2.06
  
• d5e6eb_ appears in the current release, SCOPe 2.07