SCOPe 2.08: Domain d5e9vb_: 5e9v B:

Lineage for d5e9vb_ (5e9v B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d5e9vb_: 5e9v B: [278700]
   automated match to d3hmeb_
   complexed with 5l0, edo

Details for d5e9vb_

PDB Entry: 5e9v, 1.8 Å

PDB Description: crystal structure of brd9 bromodomain in complex with an indolizine ligand

PDB Compounds: (B:) Bromodomain-containing protein 9

SCOPe Domain Sequences for d5e9vb_:

Sequence; same for both SEQRES and ATOM records:

>d5e9vb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmskerllalkrsms

Timeline for d5e9vb_:

• d5e9vb_ first appeared in SCOPe 2.05
  
• d5e9vb_ appears in SCOPe 2.07