SCOPe 2.05: Domain d5e2ea_: 5e2e A:

Lineage for d5e2ea_ (5e2e A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Yersinia enterocolitica [TaxId:393305] [278691] (1 PDB entry)

8. Domain d5e2ea_: 5e2e A: [278694]
   automated match to d1hzoa_

Details for d5e2ea_

PDB Entry: 5e2e, 1.9 Å

PDB Description: crystal structure of beta-lactamase precursor blaa from yersinia enterocolitica

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5e2ea_:

Sequence; same for both SEQRES and ATOM records:

>d5e2ea_ e.3.1.1 (A:) automated matches {Yersinia enterocolitica [TaxId: 393305]}
sldkqlaalehsangrlgiaminsgagtkilyrgaqrfpfcstfkfmlaaavldqsqsqp
nllnkhinyhesdllsyapitrknlacgmtvselcaatiqysdntaanllikelgglaav
nqfarsigdqmfrldrwepdlntalpndprdtttpaamaasmnklvlgdalrpaqrsqla
awlkgnttgdatiragaptdwivgdktgsgdygttndiavlwptkgapivlvvyftqrek
dakprrdvlasatqiilsqi

Timeline for d5e2ea_:

• d5e2ea_ is new in SCOPe 2.05-stable
  
• d5e2ea_ appears in SCOPe 2.06
  
• d5e2ea_ appears in the current release, SCOPe 2.08