Lineage for d5dkio_ (5dki O:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1935363Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1935372Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (70 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1936262Domain d5dkio_: 5dki O: [278627]
    Other proteins in same PDB: d5dkib_, d5dkic_, d5dkid_, d5dkie_, d5dkif_, d5dkig_, d5dkih_, d5dkim_, d5dkip_, d5dkiq_, d5dkir_, d5dkis_, d5dkit_, d5dkiu_, d5dkiv_
    automated match to d1jd2v_
    complexed with 5bz, cl, mg

Details for d5dkio_

PDB Entry: 5dki (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with alkyne-pi
PDB Compounds: (O:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d5dkio_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dkio_ d.153.1.4 (O:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

SCOPe Domain Coordinates for d5dkio_:

Click to download the PDB-style file with coordinates for d5dkio_.
(The format of our PDB-style files is described here.)

Timeline for d5dkio_: