Lineage for d1ugaa_ (1uga A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1136597Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1136598Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1136599Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
  6. 1136600Protein Carbonic anhydrase [51071] (10 species)
  7. 1136632Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (419 PDB entries)
    Uniprot P00918
  8. 1136905Domain d1ugaa_: 1uga A: [27862]
    complexed with zn; mutant

Details for d1ugaa_

PDB Entry: 1uga (more details), 2 Å

PDB Description: human carbonic anhydrase ii[hcaii] (e.c.4.2.1.1) mutant with ala 65 replaced by phe (a65f)
PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1ugaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugaa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghffnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOPe Domain Coordinates for d1ugaa_:

Click to download the PDB-style file with coordinates for d1ugaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ugaa_: