Lineage for d1g48a_ (1g48 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1328735Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1328736Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1328737Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 1328738Protein Carbonic anhydrase [51071] (10 species)
  7. 1328774Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (457 PDB entries)
    Uniprot P00918
  8. 1329046Domain d1g48a_: 1g48 A: [27860]
    complexed with f6b, hg, zn

Details for d1g48a_

PDB Entry: 1g48 (more details), 1.86 Å

PDB Description: carbonic anhydrase ii (f131v) complexed with 4-(aminosulfonyl)-n-[(2, 6-difluorophenyl)methyl]-benzamide
PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1g48a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g48a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOPe Domain Coordinates for d1g48a_:

Click to download the PDB-style file with coordinates for d1g48a_.
(The format of our PDB-style files is described here.)

Timeline for d1g48a_: