Lineage for d5cmaa2 (5cma A:107-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1764241Species Mus musculus [TaxId:10090] [272441] (35 PDB entries)
  8. 1764269Domain d5cmaa2: 5cma A:107-213 [278572]
    Other proteins in same PDB: d5cmaa1
    automated match to d3cfja2

Details for d5cmaa2

PDB Entry: 5cma (more details), 2.5 Å

PDB Description: anti-b7-h3 monoclonal antibody ch8h9 fab fragment
PDB Compounds: (A:) Antibody ch8H9 Fab light chain

SCOPe Domain Sequences for d5cmaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cmaa2 b.1.1.2 (A:107-213) automated matches {Mus musculus [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5cmaa2:

Click to download the PDB-style file with coordinates for d5cmaa2.
(The format of our PDB-style files is described here.)

Timeline for d5cmaa2: