Lineage for d5cmaa1 (5cma A:1-106)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1767332Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)
  8. 1767363Domain d5cmaa1: 5cma A:1-106 [278571]
    Other proteins in same PDB: d5cmaa2
    automated match to d3cfja1

Details for d5cmaa1

PDB Entry: 5cma (more details), 2.5 Å

PDB Description: anti-b7-h3 monoclonal antibody ch8h9 fab fragment
PDB Compounds: (A:) Antibody ch8H9 Fab light chain

SCOPe Domain Sequences for d5cmaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cmaa1 b.1.1.0 (A:1-106) automated matches {Mus musculus [TaxId: 10090]}
divmtqspatlsvtpgdrvslscrasqsisdylhwyqqkshesprllikyasqsisgips
rfsgsgsgsdftlsinsvepedvgvyycqnghsfpltfgagtklel

SCOPe Domain Coordinates for d5cmaa1:

Click to download the PDB-style file with coordinates for d5cmaa1.
(The format of our PDB-style files is described here.)

Timeline for d5cmaa1: