SCOPe 2.06: Domain d5cpyd_: 5cpy D:

Lineage for d5cpyd_ (5cpy D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families)

5. Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)

6. Protein Polyomavirus coat proteins [49657] (2 species)

7. Species Murine polyomavirus, strain small-plaque 16 [TaxId:10634] [49658] (11 PDB entries)

8. Domain d5cpyd_: 5cpy D: [278567]
   automated match to d1vpsa_
   complexed with gal, gol, nga, sia

Details for d5cpyd_

PDB Entry: 5cpy, 1.93 Å

PDB Description: crystal structure of murine polyomavirus pta strain vp1 in complex with the gd1a glycan

PDB Compounds: (D:) vp1

SCOPe Domain Sequences for d5cpyd_:

Sequence; same for both SEQRES and ATOM records:

>d5cpyd_ b.121.6.1 (D:) Polyomavirus coat proteins {Murine polyomavirus, strain small-plaque 16 [TaxId: 10634]}
mevldlvtgpdsvteieaflnprmgqpptpeslteggqyygwsrginlatsdtedspenn
tlptwsmaklqlpmlnedltcdtlqmweavsvktevvgsgslldvhgfnkptdtvntkgi
stpvegsqyhvfavggepldlqglvtdartkykeegvvtiktitkkdmvnkdqvlnpisk
akldkdgmypveiwhpdpaknentryfgnytggtttppvlqftntlttvlldengvgplc
kgeglylscvdimgwrvtrnydvhhwrglpryfkitlrkrwvk

Timeline for d5cpyd_:

• d5cpyd_ first appeared in SCOPe 2.05
  
• d5cpyd_ appears in SCOPe 2.07
  
• d5cpyd_ appears in the current release, SCOPe 2.08