Lineage for d4zptl1 (4zpt L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760415Domain d4zptl1: 4zpt L:1-107 [278492]
    Other proteins in same PDB: d4zpta_, d4zptb2, d4zpth_, d4zptl2
    automated match to d2v7ha1
    complexed with nag

Details for d4zptl1

PDB Entry: 4zpt (more details), 2.59 Å

PDB Description: structure of mers-coronavirus spike receptor-binding domain (england1 strain) in complex with vaccine-elicited murine neutralizing antibody d12 (crystal form 1)
PDB Compounds: (L:) D12 Fab Light chain

SCOPe Domain Sequences for d4zptl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zptl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiicrasqdinnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgsdysltisnleqediatyfcqqantlpptfgagtklelr

SCOPe Domain Coordinates for d4zptl1:

Click to download the PDB-style file with coordinates for d4zptl1.
(The format of our PDB-style files is described here.)

Timeline for d4zptl1: