Lineage for d4ykjb_ (4ykj B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880609Species Mnemiopsis leidyi [TaxId:27923] [278472] (4 PDB entries)
  8. 1880615Domain d4ykjb_: 4ykj B: [278480]
    automated match to d2i0cb_
    complexed with ala, gly

Details for d4ykjb_

PDB Entry: 4ykj (more details), 1.4 Å

PDB Description: mnemiopsis leidyi ml032222a iglur lbd complex with alanine
PDB Compounds: (B:) ML032222a iGluR

SCOPe Domain Sequences for d4ykjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ykjb_ c.94.1.0 (B:) automated matches {Mnemiopsis leidyi [TaxId: 27923]}
gsknligrhlrlgsveeqpfmffategcegndcwsgmvndmvvklsedlgftyeyiqpdd
rkfgalnkttnewngmirdllddktdmiaidlstnsarksaidysfpfmdagikavvkge
gttlnqvlelldqdkykwgvigsrhpetllkthrdsrysrlvdegvelkdlnhaietlrg
glfvfidegpvlahnlisdcdvfsvgeefqsfeyafglpkdspykslidshllkfreegf
idilwekwssgnsvc

SCOPe Domain Coordinates for d4ykjb_:

Click to download the PDB-style file with coordinates for d4ykjb_.
(The format of our PDB-style files is described here.)

Timeline for d4ykjb_: