SCOPe 2.05: Domain d4ykib_: 4yki B:

Lineage for d4ykib_ (4yki B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Mnemiopsis leidyi [TaxId:27923] [278472] (4 PDB entries)

8. Domain d4ykib_: 4yki B: [278475]
   automated match to d2i0cb_
   complexed with gly, mg, so4

Details for d4ykib_

PDB Entry: 4yki, 1.21 Å

PDB Description: mnemiopsis leidyi ml032222a iglur lbd glycine complex

PDB Compounds: (B:) ML032222a iGluR

SCOPe Domain Sequences for d4ykib_:

Sequence; same for both SEQRES and ATOM records:

>d4ykib_ c.94.1.0 (B:) automated matches {Mnemiopsis leidyi [TaxId: 27923]}
gsknligrhlrlgsveeqpfmffategcegndcwsgmvndmvvklsedlgftyeyiqpdd
rkfgalnkttnewngmirdllddktdmiaidlstnsarksaidysfpfmdagikavvkge
gttlnqvlelldqdkykwgvigsrhpetllkthrdsrysrlvdegvelkdlnhaietlrg
glfvfidegpvlahnlisdcdvfsvgeefqsfeyafglpkdspykslidshllkfreegf
idilwekwssgnsvc

Timeline for d4ykib_:

• d4ykib_ is new in SCOPe 2.05-stable
  
• d4ykib_ appears in SCOPe 2.06
  
• d4ykib_ appears in the current release, SCOPe 2.08