Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
Superfamily f.6.1: Leukocidin-like [56959] (3 families) |
Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins) heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit automatically mapped to Pfam PF07968 |
Protein automated matches [190904] (4 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [189747] (6 PDB entries) |
Domain d4yhde_: 4yhd E: [278468] automated match to d3anza_ complexed with cl; mutant |
PDB Entry: 4yhd (more details), 2.8 Å
SCOPe Domain Sequences for d4yhde_:
Sequence, based on SEQRES records: (download)
>d4yhde_ f.6.1.1 (E:) automated matches {Staphylococcus aureus [TaxId: 158878]} niktgttdigsnttvktgdlvtydkengmakkvfysfiddknhnkkllvirtkgtiagqy rvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygfngnvt gddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwgpydrd swnpvygnqlfmktrngsmkaaenfldpnkassllssgfspdfatvitmdrkaskqqtni dviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn
>d4yhde_ f.6.1.1 (E:) automated matches {Staphylococcus aureus [TaxId: 158878]} niktgttdinttvktgdlvtydkengmakkvfysfiddknkllvirtkgtiagqyrvyse eganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygtgddtvsight lkyvqpdfktilesptdkkvgwkvifnnmvnqnwgpydrdswnpvygnqlfmktrngsmk aaenfldpnkassllssgfspdfatvitmdrkaskqqtnidviyervrddyqlhwtstnw kgtntkdkwtdrsserykidwekeemtn
Timeline for d4yhde_: