SCOPe 2.05: Domain d4wyta1: 4wyt A:3-105

Lineage for d4wyta1 (4wyt A:3-105)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (42 PDB entries)

8. Domain d4wyta1: 4wyt A:3-105 [278457]
   automated match to d1mfga_
   complexed with cl

Details for d4wyta1

PDB Entry: 4wyt, 2.6 Å

PDB Description: crystal structure of scribble pdz34 tandem at 2.6 angstroms

PDB Compounds: (A:) Protein scribble homolog

SCOPe Domain Sequences for d4wyta1:

Sequence; same for both SEQRES and ATOM records:

>d4wyta1 b.36.1.1 (A:3-105) automated matches {Homo sapiens [TaxId: 9606]}
aaalegpypveeirlpraggplglsivggsdhsshpfgvqepgvfiskvlprglaarsgl
rvgdrilavngqdvrdathqeavsallrpclelsllvrrdpap

Timeline for d4wyta1:

• d4wyta1 is new in SCOPe 2.05-stable
  
• d4wyta1 appears in SCOPe 2.06
  
• d4wyta1 appears in the current release, SCOPe 2.08