Lineage for d4woqc_ (4woq C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1822946Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1822947Protein automated matches [190115] (63 species)
    not a true protein
  7. 1823320Species Peptoclostridium difficile [TaxId:525259] [278443] (1 PDB entry)
  8. 1823323Domain d4woqc_: 4woq C: [278446]
    automated match to d2ygya_
    complexed with 2kt

Details for d4woqc_

PDB Entry: 4woq (more details), 2.2 Å

PDB Description: crystal structures of cdnal from clostridium difficile in complex with ketobutyric
PDB Compounds: (C:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4woqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4woqc_ c.1.10.0 (C:) automated matches {Peptoclostridium difficile [TaxId: 525259]}
tdmkgiysallvsfdkegninekglrqiirhnidvckvdglyvggstgenfmlstdekkr
ifeiakdevkeeikliaqvgsvnlkeavelakfttdlgydaisavtpfyykfdfeeikhy
yntiinsvdnrliiysipfltgvdmsldqfgelfenekiigvkftaadfyllermrktfp
nklifagfdemmlpatvlgvdgaigstfnvngvrarqifeltknekisealevqhvtndl
itdilgnglyqtikllleeqgveagycrqpmkeatdemksrakeiyrkyf

SCOPe Domain Coordinates for d4woqc_:

Click to download the PDB-style file with coordinates for d4woqc_.
(The format of our PDB-style files is described here.)

Timeline for d4woqc_: