Class a: All alpha proteins [46456] (286 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (6 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256335] (3 PDB entries) |
Domain d4wnnd_: 4wnn D: [278430] automated match to d3mgpd_ protein/DNA complex; complexed with po4 |
PDB Entry: 4wnn (more details), 1.8 Å
SCOPe Domain Sequences for d4wnnd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wnnd_ a.22.1.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} kkrskarketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkk stisareiqtavrlilpgelakhavsegtravtkyss
Timeline for d4wnnd_: