SCOPe 2.05: Domain d4w7va_: 4w7v A:

Lineage for d4w7va_ (4w7v A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Xanthomonas axonopodis [TaxId:190486] [260217] (9 PDB entries)

8. Domain d4w7va_: 4w7v A: [278425]
   automated match to d1h1na_
   complexed with cbi

Details for d4w7va_

PDB Entry: 4w7v, 1.43 Å

PDB Description: crystal structure of xaccel5a in complex with cellobiose

PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d4w7va_:

Sequence; same for both SEQRES and ATOM records:

>d4w7va_ c.1.8.0 (A:) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
hmlkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpel
ngpldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrlal
efkddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgahswrst
sygvsnakaleilkdpgnnlafeahqyldkdysgtkpvctsdsvgqeklqgftswlrenk
qkgflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkdg
sdkpqmailskya

Timeline for d4w7va_:

• d4w7va_ is new in SCOPe 2.05-stable
  
• d4w7va_ is called d4w7va1 in SCOPe 2.06
  
• d4w7va_ appears in the current release, SCOPe 2.08, called d4w7va1