Lineage for d4rlda_ (4rld A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1798303Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 1798304Protein automated matches [190954] (9 species)
    not a true protein
  7. 1798305Species Blattella germanica [TaxId:6973] [189570] (4 PDB entries)
  8. 1798310Domain d4rlda_: 4rld A: [278406]
    automated match to d1yg9a_
    complexed with zn; mutant

Details for d4rlda_

PDB Entry: 4rld (more details), 2.9 Å

PDB Description: crystal structure of kkf mutant of bla g 2 protein
PDB Compounds: (A:) Aspartic protease Bla g 2

SCOPe Domain Sequences for d4rlda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rlda_ b.50.1.0 (A:) automated matches {Blattella germanica [TaxId: 6973]}
gasivplyklvhvfintqyagitkignqnfltvfdstscnvvvasqecvggacvcpnlqk
yeklkpkyisdgnvqvkffdtgsavgrgiedsltisqlttsqqdivladelsqevcilsa
dvvvgiaapgcpnalagktvlenfveenliapvfsihharfqdgehygeiifggsdwkyv
dgeftyvplvgddswkfrldgvkigdttvapagtqaiidtskaiivgpkayvnpineaig
cvvektttrrickldcsaipslpdvtfvingrnfnissqyyiqqngnlcysgfqpcghsd
hffigdffvdhyysefnwenktmgfgrsve

SCOPe Domain Coordinates for d4rlda_:

Click to download the PDB-style file with coordinates for d4rlda_.
(The format of our PDB-style files is described here.)

Timeline for d4rlda_: