SCOPe 2.05: Domain d4rldd_: 4rld D:

Lineage for d4rldd_ (4rld D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.0: automated matches [191552] (1 protein)
   not a true family

6. Protein automated matches [190954] (9 species)
   not a true protein

7. Species Blattella germanica [TaxId:6973] [189570] (4 PDB entries)

8. Domain d4rldd_: 4rld D: [278403]
   automated match to d1yg9a_
   complexed with zn; mutant

Details for d4rldd_

PDB Entry: 4rld, 2.9 Å

PDB Description: crystal structure of kkf mutant of bla g 2 protein

PDB Compounds: (D:) Aspartic protease Bla g 2

SCOPe Domain Sequences for d4rldd_:

Sequence; same for both SEQRES and ATOM records:

>d4rldd_ b.50.1.0 (D:) automated matches {Blattella germanica [TaxId: 6973]}
gasivplyklvhvfintqyagitkignqnfltvfdstscnvvvasqecvggacvcpnlqk
yeklkpkyisdgnvqvkffdtgsavgrgiedsltisqlttsqqdivladelsqevcilsa
dvvvgiaapgcpnalagktvlenfveenliapvfsihharfqdgehygeiifggsdwkyv
dgeftyvplvgddswkfrldgvkigdttvapagtqaiidtskaiivgpkayvnpineaig
cvvektttrrickldcsaipslpdvtfvingrnfnissqyyiqqngnlcysgfqpcghsd
hffigdffvdhyysefnwenktmgfgrsve

Timeline for d4rldd_:

• d4rldd_ is new in SCOPe 2.05-stable
  
• d4rldd_ is called d4rldd1 in SCOPe 2.06
  
• d4rldd_ appears in the current release, SCOPe 2.08, called d4rldd1