Lineage for d4jkla1 (4jkl A:-1-178)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777799Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1777800Protein automated matches [190770] (31 species)
    not a true protein
  7. 1778053Species Streptococcus agalactiae [TaxId:208435] [278382] (2 PDB entries)
  8. 1778054Domain d4jkla1: 4jkl A:-1-178 [278394]
    Other proteins in same PDB: d4jkla2, d4jkla3, d4jklb2, d4jklb3
    automated match to d4jkmb1
    complexed with mg

Details for d4jkla1

PDB Entry: 4jkl (more details), 2.29 Å

PDB Description: crystal structure of streptococcus agalactiae beta-glucuronidase in space group p21212
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d4jkla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jkla1 b.18.1.0 (A:-1-178) automated matches {Streptococcus agalactiae [TaxId: 208435]}
namlyplltktrntydlggiwnfklgehnpnellpsdevmviptsfndlmvskekrdyig
dfwyekvievpkvsedeemvlrfgsvthqakiyvdgvlvgehkggftpfevlvpeckynn
ekikvsicannvldyttlpvgnyseiiqedgsikkkvrenfdffnyagvhrplklmirpk

SCOPe Domain Coordinates for d4jkla1:

Click to download the PDB-style file with coordinates for d4jkla1.
(The format of our PDB-style files is described here.)

Timeline for d4jkla1: