SCOPe 2.05: Domain d5e74a_: 5e74 A:

Lineage for d5e74a_ (5e74 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)

8. Domain d5e74a_: 5e74 A: [278377]
   automated match to d4rvra_
   complexed with 5kh

Details for d5e74a_

PDB Entry: 5e74, 1.78 Å

PDB Description: crystal structure of baz2b bromodomain in complex with acetylindole compound uzh50

PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d5e74a_:

Sequence; same for both SEQRES and ATOM records:

>d5e74a_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv

Timeline for d5e74a_:

• d5e74a_ is new in SCOPe 2.05-stable
  
• d5e74a_ is called d5e74a1 in SCOPe 2.06
  
• d5e74a_ appears in the current release, SCOPe 2.08, called d5e74a1