SCOPe 2.05: Domain d5e38c_: 5e38 C:

Lineage for d5e38c_ (5e38 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (25 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [272972] (2 PDB entries)

8. Domain d5e38c_: 5e38 C: [278371]
   automated match to d1i5ea_
   mutant

Details for d5e38c_

PDB Entry: 5e38, 3 Å

PDB Description: structural basis of mapping the spontaneous mutations with 5- flourouracil in uracil phosphoribosyltransferase from mycobacterium tuberculosis

PDB Compounds: (C:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d5e38c_:

Sequence; same for both SEQRES and ATOM records:

>d5e38c_ c.61.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
avqvhvvdhplaaarlttlrdertdnagfraalreltllliyeatrdapcepvpirtpla
etvgsrltkppllvpvlraglgmvdeahaalpeahvgfvgvardeqthqpvpyldslpdd
ltdvpvmvldpmvatggsmthtlgllisrgaaditvlcvvaapegiaalqkaapnvrlft
aaideglnevayivpglgdagdrqf

Timeline for d5e38c_:

• d5e38c_ is new in SCOPe 2.05-stable
  
• d5e38c_ is called d5e38c1 in SCOPe 2.06
  
• d5e38c_ appears in the current release, SCOPe 2.08, called d5e38c1