Lineage for d5e38b_ (5e38 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863464Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1863465Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1863901Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 1863902Protein automated matches [190891] (25 species)
    not a true protein
  7. 1864032Species Mycobacterium tuberculosis [TaxId:83332] [272972] (2 PDB entries)
  8. 1864040Domain d5e38b_: 5e38 B: [278369]
    automated match to d1i5ea_
    mutant

Details for d5e38b_

PDB Entry: 5e38 (more details), 3 Å

PDB Description: structural basis of mapping the spontaneous mutations with 5- flourouracil in uracil phosphoribosyltransferase from mycobacterium tuberculosis
PDB Compounds: (B:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d5e38b_:

Sequence, based on SEQRES records: (download)

>d5e38b_ c.61.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
vhvvdhplaaarlttlrdertdnagfraalreltllliyeatrdapcepvpirtplaetv
gsrltkppllvpvlraglgmvdeahaalpeahvgfvgvardeqthqpvpyldslpddltd
vpvmvldpmvatggsmthtlgllisrgaaditvlcvvaapegiaalqkaapnvrlftaai
deglnevayivpglgdagdrqf

Sequence, based on observed residues (ATOM records): (download)

>d5e38b_ c.61.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
vhvvdhplaaarlttlrdertdnagfraalreltllliyeatrdapcepvpirtplaetv
gsrltkppllvpvlraglgmvdeahaalpeahvgfvmvldpmvatggsmthtlgllisrg
aaditvlcvvaapegiaalqkaapnvrlftaaideglnevayivpglgdagdrqf

SCOPe Domain Coordinates for d5e38b_:

Click to download the PDB-style file with coordinates for d5e38b_.
(The format of our PDB-style files is described here.)

Timeline for d5e38b_: