Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (21 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [278345] (1 PDB entry) |
Domain d5de0b_: 5de0 B: [278349] automated match to d2iiza_ complexed with hem |
PDB Entry: 5de0 (more details), 2.24 Å
SCOPe Domain Sequences for d5de0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5de0b_ d.58.4.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]} ksqtailpeagpfalytllkvrqnhahvlqalkalpalveeinqnqpgaeltvsvafskg fwshfemasppelidfpelgegethapstdvdvlihchatrhdllfytlrkgisdiaqdi eivdetygfryldardmtgfidgtenpkaekraevalvadgdfaggsyvmvqrfvhnlpa wnrlnlaaqekvigrtkpdsvelenvpaashvgrvdikeegkglkivrhslpygsvsgdh gllfiaychtlhnfktmlesmygvtdgktdqllrftkavtgayffapsqvmlqeltlk
Timeline for d5de0b_: