Lineage for d5c3qd_ (5c3q D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2816511Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2816512Protein automated matches [191281] (21 species)
    not a true protein
  7. 2816545Species Fungus (Neurospora crassa) [TaxId:5141] [278316] (5 PDB entries)
  8. 2816549Domain d5c3qd_: 5c3q D: [278336]
    Other proteins in same PDB: d5c3qa2
    automated match to d1odna_
    complexed with akg, edo, ni, tdr

Details for d5c3qd_

PDB Entry: 5c3q (more details), 2.05 Å

PDB Description: crystal structure of the full-length neurospora crassa t7h in complex with alpha-kg and thymine (t)
PDB Compounds: (D:) Thymine dioxygenase

SCOPe Domain Sequences for d5c3qd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c3qd_ b.82.2.0 (D:) automated matches {Fungus (Neurospora crassa) [TaxId: 5141]}
kaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfrehvf
ntsakffklpkekklevgwttpeanrgysapgrekvtqltdpaeiekirsaapdikesye
igredepghpnpwpaeqddlvgfkstmnnffdqckalhievmraiavgmgidanyfdsfv
dvgdnilrllhypavksevfkinpgqvragehtdygsitllfqdsrgglqvkspngqfid
atpientvvvnagdllarwsndtikstvhrvveppkqedvhpprysiayfcnpnhksyie
aipgtyaaeserkyeginsgkylvqrlaaty

SCOPe Domain Coordinates for d5c3qd_:

Click to download the PDB-style file with coordinates for d5c3qd_.
(The format of our PDB-style files is described here.)

Timeline for d5c3qd_: