Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (9 species) not a true protein |
Species Neurospora crassa [TaxId:5141] [278316] (4 PDB entries) |
Domain d5c3qc_: 5c3q C: [278331] automated match to d1odna_ complexed with akg, edo, ni, tdr |
PDB Entry: 5c3q (more details), 2.05 Å
SCOPe Domain Sequences for d5c3qc_:
Sequence, based on SEQRES records: (download)
>d5c3qc_ b.82.2.0 (C:) automated matches {Neurospora crassa [TaxId: 5141]} mekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfreh vfntsakffklpkekklevgwttpeanrgysapgrekvtqltdpaeiekirsaapdikes yeigredepghpnpwpaeqddlvgfkstmnnffdqckalhievmraiavgmgidanyfds fvdvgdnilrllhypavksevfkinpgqvragehtdygsitllfqdsrgglqvkspngqf idatpientvvvnagdllarwsndtikstvhrvveppkqedvhpprysiayfcnpnhksy ieaipgtyaaeserkyeginsgkylvqrlaat
>d5c3qc_ b.82.2.0 (C:) automated matches {Neurospora crassa [TaxId: 5141]} mekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfreh vfntsakffklpkekklevgwttpeanrgysappdikesyeigredepghpnpwpaeqdd lvgfkstmnnffdqckalhievmraiavgmgidanyfdsfvdvgdnilrllhypavksev fkinpgqvragehtdygsitllfqdsrgglqvkspngqfidatpientvvvnagdllarw sndtikstvhrvveppkqedvhpprysiayfcnpnhksyieaipgtyaaeserkyegins gkylvqrlaat
Timeline for d5c3qc_: