Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (13 species) not a true protein |
Species Fungus (Neurospora crassa) [TaxId:5141] [278316] (4 PDB entries) |
Domain d5c3pd_: 5c3p D: [278321] Other proteins in same PDB: d5c3pb2 automated match to d1odna_ complexed with akg, edo, ni |
PDB Entry: 5c3p (more details), 2.1 Å
SCOPe Domain Sequences for d5c3pd_:
Sequence, based on SEQRES records: (download)
>d5c3pd_ b.82.2.0 (D:) automated matches {Fungus (Neurospora crassa) [TaxId: 5141]} mekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfreh vfntsakffklpkekklevgwttpeanrgysapgrekvtqltdpaeiekirsaapdikes yeigredepghpnpwpaeqddlvgfkstmnnffdqckalhievmraiavgmgidanyfds fvdvgdnilrllhypavksevfkinpgqvragehtdygsitllfqdsrgglqvkspngqf idatpientvvvnagdllarwsndtikstvhrvveppkqedvhpprysiayfcnpnhksy ieaipgtyaaeserkyeginsgkylvqrlaa
>d5c3pd_ b.82.2.0 (D:) automated matches {Fungus (Neurospora crassa) [TaxId: 5141]} mekaavnedglviplidfskflegdetlkletakailhgfqtagfiylknipiqpdfreh vfntsakffklpkekklevgwpeanrgysadikesyeigredepghpnpwpaelvgfkst mnnffdqckalhievmraiavgmgidanyfdsfvdvgdnilrllhypavksevfkinpgq vragehtdygsitllfqdsrgglqvkspngqfidatpientvvvnagdllarwsndtiks tvhrvveppkqedvhpprysiayfcnpnhksyieaipgtyaaeserkyeginsgkylvqr laa
Timeline for d5c3pd_:
View in 3D Domains from other chains: (mouse over for more information) d5c3pa_, d5c3pb1, d5c3pb2, d5c3pc_ |