SCOPe 2.08: Domain d5bncb_: 5bnc B:

Lineage for d5bncb_ (5bnc B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (22 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [278309] (2 PDB entries)

8. Domain d5bncb_: 5bnc B: [278312]
   automated match to d2arzb_
   complexed with epe, mg, ni, so4

Details for d5bncb_

PDB Entry: 5bnc, 2.25 Å

PDB Description: structure of heme binding protein msmeg_6519 from mycobacterium smegmatis

PDB Compounds: (B:) heme binding protein MSMEG_6519

SCOPe Domain Sequences for d5bncb_:

Sequence; same for both SEQRES and ATOM records:

>d5bncb_ b.45.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
vvrpsaaeeartiaastnvgtlatlttegdpwasfvtygllggapvlcvsdmaehgrnla
hdprasiaivapsaesdplasarvtlagvaerpegdelaaaraahldavaaakyyidysd
fsvwvlrvqrvrwvggygrmdsttgeayaaaeadpvtpraagaiahlnadhadsllamar
nlggypdtgeavctgadrygldlrvttergvaytrvgyaapissfdqlraatvelaqrak
qs

Timeline for d5bncb_:

• d5bncb_ first appeared in SCOPe 2.05
  
• d5bncb_ appears in SCOPe 2.07