SCOPe 2.08: Domain d5awia_: 5awi A:

Lineage for d5awia_ (5awi A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein Cytochrome b562 [47177] (1 species)

7. Species Escherichia coli [TaxId:562] [47178] (75 PDB entries)

8. Domain d5awia_: 5awi A: [278307]
   automated match to d2bc5a_
   complexed with hec, so4, zn

Details for d5awia_

PDB Entry: 5awi, 1.85 Å

PDB Description: domain-swapped cytochrome cb562 dimer

PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d5awia_:

Sequence; same for both SEQRES and ATOM records:

>d5awia_ a.24.3.1 (A:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
frhgfdilvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr

Timeline for d5awia_:

• d5awia_ first appeared in SCOPe 2.05
  
• d5awia_ appears in SCOPe 2.07