SCOPe 2.08: Domain d5anrb2: 5anr B:302-462

Lineage for d5anrb2 (5anr B:302-462)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d5anrb2: 5anr B:302-462 [278305]
   automated match to d4ct4b2
   protein/RNA complex

Details for d5anrb2

PDB Entry: 5anr, 2.1 Å

PDB Description: structure of a human 4e-t - ddx6 - cnot1 complex

PDB Compounds: (B:) probable ATP-dependent RNA helicase ddx6

SCOPe Domain Sequences for d5anrb2:

Sequence, based on SEQRES records:

>d5anrb2 c.37.1.0 (B:302-462) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeltlkgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisqlgysc
fyihakmrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfdfpklaetylhr
igrsgrfghlglainlityddrfnlksieeqlgteikpips

Sequence, based on observed residues (ATOM records):

>d5anrb2 c.37.1.0 (B:302-462) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeltlkgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisqlgysc
fyihakmrqehrnrvfhdfrnglcrnlvctdlfdiqavnvvinfdfpklaetylhrigrs
glglainlityddrfnlksieeqlgteikpips

Timeline for d5anrb2:

• d5anrb2 first appeared in SCOPe 2.05
  
• d5anrb2 appears in SCOPe 2.07