SCOPe 2.05: Domain d5ausa_: 5aus A:

Lineage for d5ausa_ (5aus A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c552 [46636] (6 species)

7. Species Hydrogenobacter thermophilus [TaxId:940] [46640] (6 PDB entries)

8. Domain d5ausa_: 5aus A: [278298]
   automated match to d1ynra_
   complexed with hec

Details for d5ausa_

PDB Entry: 5aus, 1.3 Å

PDB Description: hydrogenobacter thermophilus cytochrome c552 dimer formed by domain swapping at c-terminal region

PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d5ausa_:

Sequence, based on SEQRES records:

>d5ausa_ a.3.1.1 (A:) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkagggkkvgpayadvakkyagrkdavdylagkikkggsgvwgsv
pmppqnvtdaeakqlaqwilsik

Sequence, based on observed residues (ATOM records):

>d5ausa_ a.3.1.1 (A:) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkakvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmpp
qnvtdaeakqlaqwilsik

Timeline for d5ausa_:

• d5ausa_ is new in SCOPe 2.05-stable
  
• d5ausa_ appears in SCOPe 2.06
  
• d5ausa_ appears in the current release, SCOPe 2.08