Lineage for d5aurg_ (5aur G:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1719638Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1719734Protein Cytochrome c552 [46636] (6 species)
  7. 1719735Species Hydrogenobacter thermophilus [TaxId:940] [46640] (6 PDB entries)
  8. 1719739Domain d5aurg_: 5aur G: [278297]
    automated match to d1ynra_
    complexed with hec, iod

Details for d5aurg_

PDB Entry: 5aur (more details), 1.26 Å

PDB Description: hydrogenobacter thermophilus cytochrome c552 dimer formed by domain swapping at n-terminal region
PDB Compounds: (G:) Cytochrome c-552

SCOPe Domain Sequences for d5aurg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aurg_ a.3.1.1 (G:) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkagggkkvgpayadvakkyagrkdavdylagkikkggsgvwgsv
pmppqnvtdaeakqlaqwilsik

SCOPe Domain Coordinates for d5aurg_:

Click to download the PDB-style file with coordinates for d5aurg_.
(The format of our PDB-style files is described here.)

Timeline for d5aurg_: