Lineage for d5acka_ (5ack A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1932524Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 1932525Protein automated matches [190417] (21 species)
    not a true protein
  7. 1932655Species Human (Homo sapiens) [TaxId:9606] [187294] (615 PDB entries)
  8. 1932675Domain d5acka_: 5ack A: [278296]
    automated match to d4aw1a_
    complexed with atp, dms, dtd, na, svq

Details for d5acka_

PDB Entry: 5ack (more details), 1.24 Å

PDB Description: human pdk1 kinase domain in complex with allosteric compound 7 bound to the pif-pocket
PDB Compounds: (A:) 3-phosphoinositide-dependent protein kinase 1

SCOPe Domain Sequences for d5acka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5acka_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrerd
vmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivsa
leylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaransfvgtaqyvspe
llteksackssdlwalgciiyqlvaglppfragneglifakiikleydfpekffpkardl
vekllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt

SCOPe Domain Coordinates for d5acka_:

Click to download the PDB-style file with coordinates for d5acka_.
(The format of our PDB-style files is described here.)

Timeline for d5acka_: