SCOPe 2.03: Domain d1fr7a_: 1fr7 A:

Lineage for d1fr7a_ (1fr7 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (457 PDB entries)
   Uniprot P00918

8. Domain d1fr7a_: 1fr7 A: [27828]
   complexed with zn

Details for d1fr7a_

PDB Entry: 1fr7, 1.5 Å

PDB Description: x-ray crystal structure of zinc-bound f93s/f95l/w97m carbonic anhydrase (caii) variant

PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1fr7a_:

Sequence; same for both SEQRES and ATOM records:

>d1fr7a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqshlhmgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasfk

Timeline for d1fr7a_:

• d1fr7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fr7a_ appears in SCOPe 2.02
  
• d1fr7a_ appears in SCOPe 2.04
  
• d1fr7a_ appears in the current release, SCOPe 2.08