SCOPe 2.05: Domain d4zxma_: 4zxm A:

Lineage for d4zxma_ (4zxm A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.0: automated matches [191348] (1 protein)
   not a true family

6. Protein automated matches [190280] (4 species)
   not a true protein

7. Species Branchiostoma belcheri [TaxId:155462] [278267] (1 PDB entry)

8. Domain d4zxma_: 4zxm A: [278268]
   automated match to d1s2jb_

Details for d4zxma_

PDB Entry: 4zxm, 2.8 Å

PDB Description: crystal structure of pgrp domain from branchiostoma belcheri tsingtauense peptidoglycan recognition protein 3

PDB Compounds: (A:) PGRP domain of peptidoglycan recognition protein 3

SCOPe Domain Sequences for d4zxma_:

Sequence; same for both SEQRES and ATOM records:

>d4zxma_ d.118.1.0 (A:) automated matches {Branchiostoma belcheri [TaxId: 155462]}
tcprivsksewgsratnynvflslpvpkvvihhsagatcstqsscslqvrniqnyhmdgr
gysdigynflvgndgnvyegrgwdrrgahalnvntesigicfmgdftsqkptasaiaaak
sliscgvslgkirsgyslyghrdvgstacpgnllyddikswgryv

Timeline for d4zxma_:

• d4zxma_ is new in SCOPe 2.05-stable
  
• d4zxma_ appears in SCOPe 2.06
  
• d4zxma_ appears in the current release, SCOPe 2.08