Lineage for d1cama_ (1cam A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1328735Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1328736Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1328737Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 1328738Protein Carbonic anhydrase [51071] (10 species)
  7. 1328774Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (457 PDB entries)
    Uniprot P00918
  8. 1328939Domain d1cama_: 1cam A: [27826]
    complexed with bct, zn

Details for d1cama_

PDB Entry: 1cam (more details), 1.7 Å

PDB Description: structural analysis of the zinc hydroxide-thr 199-glu 106 hydrogen bonding network in human carbonic anhydrase ii
PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1cama_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cama_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslatppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOPe Domain Coordinates for d1cama_:

Click to download the PDB-style file with coordinates for d1cama_.
(The format of our PDB-style files is described here.)

Timeline for d1cama_: