Lineage for d1cam__ (1cam -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17446Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
  4. 17447Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 17448Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 17449Protein Carbonic anhydrase [51071] (8 species)
  7. 17460Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (128 PDB entries)
  8. 17466Domain d1cam__: 1cam - [27826]

Details for d1cam__

PDB Entry: 1cam (more details), 1.7 Å

PDB Description: structural analysis of the zinc hydroxide-thr 199-glu 106 hydrogen bonding network in human carbonic anhydrase ii
PDB Compounds: ( :)

SCOP Domain Sequences for d1cam__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cam__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslatppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOP Domain Coordinates for d1cam__:

Click to download the PDB-style file with coordinates for d1cam__.
(The format of our PDB-style files is described here.)

Timeline for d1cam__: